Happy Friday everyone!

Gosh, it’s been a crazy week trying to get back into the swing of things after vacation. You know how it goes! I’m excited to relax, re-assess and get my life back in order this weekend. It’s supposed to be chilly, which will help force me to stay indoors and get organized.

Yay? ;)

What are your weekend plans? Got any weddings to go to?

I feel like I’m seriously lacking in weddings to attend this spring and summer, and you know how much I adore them. Sigh. Come on, guys – pop that question! ;)

Random thoughts aside, have a wonderful weekend, and please enjoy my favorite finds from around the web in this week’s Friday Favorites!

Favorite devour: Red Velvet Brownies. Red, chocolate, chewy lusciousness. OMG.

redvelvetbrownies

Favorite print. Gosh, so true!

changenothing

Favorite bite: Apricot & Goat Cheese Bites. Ummmm, pretty much all my favorite things in one poppable bite. So genius.

apricotbites

Favorite color pop. I adore the gold accents with the bright fuschia and tangerine colors of the dress. The turquoise purse totally takes it over the top.

colordress

Favorite picture. Pure happiness! I need this as a poster, or something. :)

dog

Favorite funny. Engaged people – you HAVE TO DO THIS on your wedding day!!!!

Grom-Portrait1

Favorite supper: Martha Stewart’s Half Hour Chicken Gumbo. The weather has gone from high 80s everyday down to the 50s over the past couple of weeks, which makes coming home to a hot pot of hearty soup ready in half hour sound blissfully cozy. :)

halfhourchickengumbo

Favorite tank: J Crew Stripes. For, you know, when the weather gets back into the 80s! ;)

jcrewtank

Favorite DIY: Knock-Off Anthropologie Letters. Brilliant, and CHEAP!

knockoffanthropologieletters

Favorite mouthwater: La Jolla Crab Stack. The epitome of refreshing. Summer. Fresh.

la-jolla-crab-stack

Favorite home accent: Giraffe Bookends. Just the feel of this makes me want to go on safari. :)

giraffebookends

Favorite show: GCB. If I had to give up all shows to watch just one show…it would for sure be GCB (stands for Good Christian B!itches.) It is SO hilarious and smart – it actually makes me look forward to Sunday nights!

Favorite healthy sweet: Lemon & Zucchini Muffins. Fluffy, moist zucchini muffins, with a sweet, lemon twist. These will definitely be made this summer!

lemonzucchinimuffins

Favorite sigh: Positano, Amalfi Coast, Italy. I wish I was someone who could sweetly say, awww, remember when?! after seeing something that reminds them of an epic vacation. My response is usually a wailing WHYYYYYYYY??? WHY CAN’T I GO BACK?!” Ahem! Anyways, this snapshot made my heart absolutely ache for the Amalfi Coast adventure Ben and I took a couple years ago. The little beach in the back right is “our beach”!

Positano Italy

Favorite squeal. Hot sand! Hot sand! Hot sand!

running_chick

Favorite tip: Dish Soap in Oil Bottles. Keep dish soap handy without having to look at unsightly bottles, by pouring it into pretty liquid dispensers!

soapbottles

Favorite sip: Strawberry Basil Sangria. I am so intrigued by this herby-sweet concoction. I can’t wait to try it!

strawberrybasilsangria

Favorite find: Swimsuit Cover Up Wrap. Love this unique, wrappy swimsuit coverup. Check out the how-to!

swimsuitcoverup

Favorite summer treat: Vanilla Cake with Strawberry Cream Frosting. Can you tell I’m loving the strawberries lately?! They’ve been out in full force at the grocery stores lately. I’m trying to tell myself to wait just a little bit longer to buy some, but it’s hard!

vanillacakeiwthstrawberrycreamfrosting

Favorite relax: Wine Holding Chair. Yes, please. Two, please.

wineholdingchair

Favorite nosh: Spicy Fries with Garlic Cheese Sauce. IN MAH FACE!

bakedspicyfrieswithgarliccheesesauce

View past Friday Favorites >

Have an awesome weekend everyone!

Like this recipe? Share it with friends!

Related Recipes

Leave a Comment

Your email address will not be published. Required fields are marked *

58 Comments

  1. Robin R says:

    Hello, I was wondering if you had the recipe for the Lemon Zucchini muffins? (I want to make them for the MOMS group at church tomorrow morning) I clicked on that link but that domain no longer exists.

    Thank you : )

    1. Kristin says:

      Aw man, looks like the site is no longer up and running. I’m sorry!

  2. Georgia Hall says:

    I really like the swimsuit cover up wrap, and it says check out the how-to, but when I click on the link, it takes me to a Victoria’s Secret site! Can you please tell me how to find the how-to? I want to make these for my daughters and daughter-in-laws.